Loading...
Loading...
Loading...
Loading...
Macrophage Migration Inhibitory Factor, Human Recombinant (Active)
| Size | 3x10 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | P14174 |
| Gene Id | 4282 |
| Protein Name / Synonyms | Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF. |
| Expressed Region | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA. |
| Expression System | E. coli |
| Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5. |
| Activity | Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml. |
| Reconstitution | It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml. |
| Research Area | Cancer, Inflammation |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.
Macrophage Migration Inhibitory Factor, Human Recombinant (Active)