Loading...
Loading...
Loading...
Loading...
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Mouse |
| Accession Number | P51654 |
| Gene Id | 2719 |
| Gene Symbols | GPC3 OCI5 |
| Protein Name / Synonyms | Glypican-3 (511~560aa) |
| Clonality | Monoclonal |
| Clone | 2H3-D3-E7 |
| Immunogen | Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography. |
| Immunogen Sequence | KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS |
| Recommended Applications | ELISA (recommended work dilution = 1:320, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
The GPC3 gene encodes a 70-kDa precursor core protein that can be cleaved by furin to generate a 40-kDa amino (N) terminal protein and a 30-kDa membrane-bound carboxyl (C) terminal protein. The C-terminus is attached to the cell membrane by a glycosylphosphatidylinositol (GPI) anchor. GPC3 has been suggested as a target for antibody and cell-based immunotherapies.
Western Blot
10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.
Lane:
M: protein marker
1: Hela cell lysate (10 µl)
2: HepG2 cell lysate (10 µl)
3: Mouse Liver lysate (10 µl)
Storage
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Expiration:
12 months from the date of shipment when stored properly.