Mouse Anti-Human ACSL5
Human ACSL5 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | ACS2, ACS5, FACL5 |
| Accession Number | NP_057318 |
| Gene Symbols | ACSL5 |
| Gene Id | 51703 |
| Applications | WB, ELISA, IP, IHC, IF |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDA KTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDR AEYLGSCLLHKGYKSS |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.3 KDa). |
 | ACSL5 monoclonal antibody Western Blot analysis of ACSL5 expression in HepG2 . |
 | Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate(82.3 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
 | Immunoprecipitation of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody. |
 | Detection limit for recombinant GST tagged ACSL5 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
