Mouse Anti-Human ACVR1B
Human ACVR1B monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | ACTRIB, ACVRLK4, ALK4, SKR2 |
| Accession Number | AAH00254 |
| Gene Symbols | ACVR1B |
| Gene Id | 91 |
| Applications | WB, ELISA, PLA |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGME HHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNR IDLRVPSGHLKEPEHPSMWGPVE |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.96 KDa). |
 | Western Blot analysis of ACVR1B expression in transfected 293T cell line by ACVR1B monoclonal antibody. Lane 1: ACVR1B transfected lysate (Predicted MW: 56.8 KDa). Lane 2: Non-transfected lysate. |
 | Proximity Ligation Analysis of protein-protein interactions between XIAP and ACVR1B HeLa cells were stained with anti-XIAP rabbit purified polyclonal 1:1200 and anti-ACVR1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
 | Detection limit for recombinant GST tagged ACVR1B is approximately 0.03ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
