Mouse Anti-Human BAG1
Human BAG1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Accession Number | NP_004314 |
| Gene Symbols | BAG1 |
| Gene Id | 573 |
| Applications | WB, ELISA, IHC, IF |
| Concentration (lot specific) | 0.5 mg/ml |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA TIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLA ECDTVEQNICQETERLQSTNFALAE |
| Gene Names | BAG1 |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Mouse, Rat |
 | Western Blot detection against Immunogen (37.29 KDa). | ||||
 | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in Raw 264.7. | ||||
 | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in PC-12. | ||||
 | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in NIH/3T3. |  | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in LNCaP . |  | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in Jurkat . |
 | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa . | ||||
 | Immunoperoxidase of monoclonal antibody to BAG1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] | ||||
 | Immunofluorescence of monoclonal antibody to BAG1 on HeLa cell. [antibody concentration 35 ug/ml] | ||||
 | Detection limit for recombinant GST tagged BAG1 is approximately 0.03ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
