Mouse Anti-Human BMP2K
Human BMP2K monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | BIKE, DKFZp434K0614, DKFZp434P0116, HRIHFB2017 |
| Accession Number | AAH36021 |
| Gene Symbols | BMP2K |
| Gene Id | 55589 |
| Applications | WB, ELISA, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYT SSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPP DMSGWNPFGEDNFSKLTEEELLDREFDLLRS |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (37.84 KDa). |
 | Western blot analysis of BMP2K over-expressed 293 cell line, cotransfected with BMP2K Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BMP2K monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | Western Blot analysis of BMP2K expression in transfected 293T cell line by BMP2K monoclonal antibody Lane 1: BMP2K transfected lysate(73.9 KDa). Lane 2: Non-transfected lysate. |
 | Immunofluorescence of monoclonal antibody to BMP2K on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged BMP2K is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
