Mouse Anti-Human CFLAR
Human CFLAR monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS |
| Accession Number | AAH01602 |
| Gene Symbols | CFLAR |
| Gene Id | 8837 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQL GAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLII DCIGNETELLRDTFTSLGYE |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.63 KDa). |
 | CFLAR monoclonal antibody. Western Blot analysis of CFLAR expression in K-562. |
 | CFLAR monoclonal antibody Western Blot analysis of CFLAR expression in IMR-32 . |
 | Western Blot analysis of CFLAR expression in transfected 293T cell line by CFLAR monoclonal antibody . Lane 1: CFLAR transfected lysate (Predicted MW: 55.3 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to CFLAR on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
 | Immunofluorescence of monoclonal antibody to CFLAR on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged CFLAR is approximately 0.3ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
