Mouse Anti-Human CKMT1B
Human CKMT1B monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | CKMT, CKMT1, UMTCK |
| Accession Number | NP_066270 |
| Gene Symbols | CKMT1B |
| Gene Id | 1159 |
| Applications | WB, ELISA |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGV FDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDI RIPTPVIHTKH |
| Gene Names | CKMT1B |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (35.75 KDa). |
 | Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | CKMT1B monoclonal antibody Western Blot analysis of CKMT1B expression in A-431 . |
 | Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody. Lane 1: CKMT1B transfected lysate(47 KDa). Lane 2: Non-transfected lysate. |
 | Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
