Mouse Anti-Human CPSF3
Human CPSF3 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | CPSF, CPSF-73, CPSF73, YSH1 |
| Accession Number | NP_057291 |
| Gene Symbols | CPSF3 |
| Gene Id | 51692 |
| Applications | WB, ELISA, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGE DCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDES LREMVELAAQRLYEALTPVH |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Mouse, Rat |
 | Western Blot detection against Immunogen (36.74 KDa). |
 | CPSF3 monoclonal antibody Western Blot analysis of CPSF3 expression in Raw 264.7. |
 | CPSF3 monoclonal antibody Western Blot analysis of CPSF3 expression in PC-12. |
 | CPSF3 monoclonal antibody Western Blot analysis of CPSF3 expression in NIH/3T3. |
 | CPSF3 monoclonal antibody Western Blot analysis of CPSF3 expression in Hela NE . |
 | Western Blot analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody. Lane 1: CPSF3 transfected lysate(77.5 KDa). Lane 2: Non-transfected lysate. |
 | Immunofluorescence of monoclonal antibody to CPSF3 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged CPSF3 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
