Human CSNK2A1 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH11668 |
| Gene Id | 1457 |
| Gene Symbols | CSNK2A1 |
| Protein Name / Synonyms | CK2A1, CKII |
| Clonality | Monoclonal |
| Immunogen Sequence | MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQ LVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKR EIKILENLRGGPNIITLADI |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Proximity Ligation Analysis, Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | CSNK2A1 monoclonal antibody Western Blot analysis of CSNK2A1 expression in Hela NE . |
![]() | Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody. Lane 1: CSNK2A1 transfected lysate(45.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between TP53 and CSNK2A1 HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-CSNK2A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged CSNK2A1 is approximately 3ng/ml as a capture antibody. |
Your cart is empty.
Anti-CSNK2A1 Antibody
Anti-CSNK2A1 Antibody