Mouse Anti-Human CSRP3
Human CSRP3 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | CLP, CMD1M, CMH12, CRP3, LMO4, MGC14488, MGC61993, MLP |
| Accession Number | NP_003467 |
| Gene Symbols | CSRP3 |
| Gene Id | 8048 |
| Applications | WB, ELISA, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | SPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVM GGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAK NFGPTGIGFGGLTQQVEKKE |
| Gene Names | CSRP3 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.74 KDa). |
 | Western blot analysis of CSRP3 over-expressed 293 cell line, cotransfected with CSRP3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSRP3 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | CSRP3 monoclonal antibody Western Blot analysis of CSRP3 expression in Hela NE. |
 | Western Blot analysis of CSRP3 expression in transfected 293T cell line by CSRP3 monoclonal antibody. Lane 1: CSRP3 transfected lysate(20.969 KDa). Lane 2: Non-transfected lysate. |
 | Immunofluorescence of monoclonal antibody to CSRP3 on HeLa cell. [antibody concentration 10 ug/ml] |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
