Mouse Anti-Human FAS
Human FAS monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6 |
| Accession Number | NP_000034 |
| Gene Symbols | FAS |
| Gene Id | 355 |
| Applications | WB, ELISA, PLA |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFC HKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSS KCRRCRLCDEGHGLEVEINC |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.74 KDa). |
 | Western Blot analysis of FAS expression in transfected 293T cell line by FAS monoclonal antibody. Lane 1: FAS transfected lysate(37.732 KDa). Lane 2: Non-transfected lysate. |
 | Proximity Ligation Analysis of protein-protein interactions between FADD and FAS. HeLa cells were stained with anti-FADD rabbit purified polyclonal 1:1200 and anti-FAS mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
 | Detection limit for recombinant GST tagged FAS is 3 ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
