Mouse Anti-Human HCLS1
Human HCLS1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | CTTNL, HS1 |
| Accession Number | AAH16758 |
| Gene Symbols | HCLS1 |
| Gene Id | 3059 |
| Applications | WB, ELISA, IHC, IF, PLA |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPP VGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALP PRTLEGLQVE |
| Gene Names | HCLS1 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (35.64 KDa). |
 | Western blot analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | HCLS1 monoclonal antibody Western Blot analysis of HCLS1 expression in K-562 . |
 | Western Blot analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody. Lane 1: HCLS1 transfected lysate(54 KDa). Lane 2: Non-transfected lysate. |
 | Proximity Ligation Analysis of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
 | Immunoperoxidase of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
 | Detection limit for recombinant GST tagged HCLS1 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
