Mouse Anti-Human HSPA1L
Human HSPA1L monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | HSP70-1L, HSP70-HOM, HSP70T, hum70t |
| Accession Number | NP_005518 |
| Gene Symbols | HSPA1L |
| Gene Id | 3305 |
| Applications | WB, ELISA, IHC, IF, PLA |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEV D |
| Gene Names | HSPA1L |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Rat |
 | Western Blot detection against Immunogen (34.65 KDa). |
 | HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12 . |
 | HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in HeLa . |
 | Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and HSPA1L HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-HSPA1L mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
 | Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
 | Detection limit for recombinant GST tagged HSPA1L is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
