Mouse Anti-Human IL1F9
Human IL1F9 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Accession Number | NP_062564 |
| Gene Symbols | IL1F9|IL-1F9|IL-1H1|IL-1RP2|IL1E|IL1H1|IL1RP2|IL1F9 |
| Gene Id | 56300 |
| Applications | WB, ELISA |
| Concentration (lot specific) | 0.46 mg/ml |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQ NLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQ NPEMCLYCEKVGEQPTLQLKEQKIMDLYGQdiv class="ty-product-feature__value">Partial recombinant protein with GST tag. ,MW of the GST tag alone is 26KDa. |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (37.84 KDa). |
 | Detection limit for recombinant GST tagged IL1F9 is 0.03 ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
