Mouse Anti-Human LRIT3
Human LRIT3 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | FIGLER4, FLJ44691, MGC120618 |
| Accession Number | NP_940908 |
| Gene Symbols | LRIT3 |
| Gene Id | 345193 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWT RSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC |
| Gene Names | LRIT3 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (33.99 KDa). |
 | Western Blot analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody. Lane 1: LRIT3 transfected lysate(60.521 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to LRIT3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.2 ug/ml] |
 | Detection limit for recombinant GST tagged LRIT3 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
