Mouse Anti-Human MCFD2
Human MCFD2 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | DKFZp686G21263, F5F8D, LMAN1IP, SDNSF |
| Accession Number | AAH40357 |
| Gene Symbols | MCFD2 |
| Gene Id | 90411 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMG LDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMH DYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINI IDGVLRDDDKNNDGYIDYAEFAKSLQ |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (41.8 KDa). |
 | Western blot analysis of MCFD2 over-expressed 293 cell line, cotransfected with MCFD2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MCFD2 monoclonal antibody G4. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | Western Blot analysis of MCFD2 expression in transfected 293T cell line by MCFD2 monoclonal antibody G4. Lane 1: MCFD2 transfected lysate(16.4 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to MCFD2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml] |
 | Detection limit for recombinant GST tagged MCFD2 is 1 ng/ml as a capture antibody. |
 | Detection limit for recombinant GST tagged MCFD2 is 0.1 ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
