Mouse Anti-Human MIB1
Human MIB1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Accession Number | NP_065825 |
| Gene Symbols | MIB1 |
| Gene Id | 57534 |
| Applications | ELISA |
| Concentration (lot specific) | 0.3 mg/ml |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | div class="ty-product-feature__label">Immunogen Sequencediv class="ty-product-feature__value">PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQ KLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDR MSECPICRKAIERRILLY |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Detection limit for recombinant GST tagged MIB1 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
