Mouse Anti-Human NEK10
Human NEK10 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | FLJ32685 |
| Accession Number | NP_689747 |
| Gene Symbols | NEK10 |
| Gene Id | 152110 |
| Applications | WB, ELISA, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASL KSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLEN AEKDTYSEVD |
| Gene Names | NEK10 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Mouse |
 | Western Blot detection against Immunogen (35.64 KDa). |
 | NEK10 monoclonal antibody Western Blot analysis of NEK10 expression in Raw 264.7 . |
 | NEK10 monoclonal antibody Western Blot analysis of NEK10 expression in NIH/3T3 . |
 | NEK10 monoclonal antibody Western Blot analysis of NEK10 expression in HeLa . |
 | Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody. Lane 1: NEK10 transfected lysate(53.1 KDa). Lane 2: Non-transfected lysate. |
 | Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged NEK10 is approximately 0.03ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
