Mouse Anti-Human ORM1
Human ORM1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Accession Number | AAH26238 |
| Gene Symbols | ORM1 |
| Gene Id | 5004 |
| Applications | WB, ELISA, IP, IHC, IF |
| Concentration (lot specific) | 0.5mg/ml |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | AQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNK SVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYL NVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDE KNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTD WKKDKCEPLEKQHEKERKQEEGES |
| Gene Names | ORM1 |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (45.98 KDa). | ||||
 | Western blot analysis of ORM1 over-expressed 293 cell line, cotransfected with ORM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ORM1 monoclonal antibody 1F10. GAPDH ( 36.1 kDa ) used as specificity and loading control. | ||||
 | ORM1 monoclonal antibody 1F10 Western Blot analysis of ORM1 expression in MCF-7 . | ||||
 | Western Blot analysis of ORM1 expression in transfected 293T cell line by ORM1 monoclonal antibody 1F10. Lane 1: ORM1 transfected lysate(23.5 KDa). Lane 2: Non-transfected lysate. |  | Immunoperoxidase of monoclonal antibody to ORM1 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 1 ug/ml] |  | Immunoprecipitation of ORM1 transfected lysate using anti-ORM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ORM1 MaxPab rabbit polyclonal antibody. |
 | Detection limit for recombinant GST tagged ORM1 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
