Mouse Anti-Human PML
Human PML monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | MYL, PP8675, RNF71, TRIM19 |
| Accession Number | AAH00080 |
| Gene Symbols | PML |
| Gene Id | 5371 |
| Applications | WB, ELISA, IF, PLA |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKE ARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVF LPNSNHVASGAGEAEERVVV |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Rat |
 | Western Blot detection against Immunogen (36.63 KDa). |
 | PML monoclonal antibody. Western Blot analysis of PML expression in PC-12. |
 | PML monoclonal antibody Western Blot analysis of PML expression in Hela NE . |
 | Proximity Ligation Analysis of protein-protein interactions between TP53 and PML HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PML mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
 | Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged PML is approximately 0.3ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
