Mouse Anti-Human POU5F1
Human POU5F1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | MGC22487, OCT3, OCT4, OTF3, OTF4 |
| Accession Number | AAH20712 |
| Gene Symbols | POU5F1 |
| Gene Id | 5460 |
| Applications | WB, ELISA, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAP GPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSP MHSN |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (35.24 KDa). |
 | POU5F1 monoclonal antibody Western Blot analysis of POU5F1 expression in HepG2 . |
 | Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody . Lane 1: POU5F1 transfected lysate(18.3 KDa). Lane 2: Non-transfected lysate. |
 | Immunofluorescence of monoclonal antibody to POU5F1 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Immunofluorescence of monoclonal antibody to POU5F1 on A-549 cell. [antibody concentration 10 ug/ml] |
 | A-549 cells were stained with POU5F1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue). |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
