Mouse Anti-Human RAF1
Human RAF1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | CRAF, NS5, Raf-1, c-Raf |
| Accession Number | AAH18119 |
| Gene Symbols | RAF1 |
| Gene Id | 5894 |
| Applications | WB, ELISA, PLA |
| Isotype | kappa, Igg2b |
| Immunogen Sequence | MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQR RASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHD CLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS LIGEELQVDF |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Rat |
 | Western Blot detection against Immunogen (39.93 KDa). |
 | RAF1 monoclonal antibody Western Blot analysis of RAF1 expression in rat brain. |
 | Western blot analysis of RAF1 over-expressed 293 cell line, cotransfected with RAF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAF1 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | RAF1 monoclonal antibody Western Blot analysis of RAF1 expression in HeLa. |
 | Western Blot analysis of RAF1 expression in transfected 293T cell line by RAF1 monoclonal antibody. Lane 1: RAF1 transfected lysate(73.1 KDa). Lane 2: Non-transfected lysate. |
 | Proximity Ligation Analysis of protein-protein interactions between PDGFRB and RAF1. Huh7 cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-RAF1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
 | Proximity Ligation Analysis of protein-protein interactions between BAD and RAF1. HeLa cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-RAF1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
