Mouse Anti-Human RFC4
Human RFC4 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | A1, MGC27291, RFC37 |
| Accession Number | AAH17452 |
| Gene Symbols | RFC4 |
| Gene Id | 5984 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVV KDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAE VDKCLADGADEHLQLISLCATVMQQLSQNC |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (37.73 KDa). |
 | Western blot analysis of RFC4 over-expressed 293 cell line, cotransfected with RFC4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RFC4 monoclonal antibody . GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | RFC4 monoclonal antibody Western Blot analysis of RFC4 expression in K-562 . |
 | Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody . Lane 1: RFC4 transfected lysate(39.7 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
 | Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
