Mouse Anti-Human RNF2
Human RNF2 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | BAP-1, BAP1, DING, HIPI3, RING1B, RING2 |
| Accession Number | NP_009143 |
| Gene Symbols | RNF2 |
| Gene Id | 6045 |
| Applications | WB, ELISA, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFR PHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEE LRSKGESNQMNLDTASEKQ |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Mouse, Rat |
 | Western Blot detection against Immunogen (36.63 KDa). |
 | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in human placenta. |
 | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in Raw 264.7. |
 | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in PC-12. |
 | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in NIH/3T3. |
 | RNF2 monoclonal antibody Western Blot analysis of RNF2 expression in Hela NE . |
 | Immunofluorescence of monoclonal antibody to RNF2 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged RNF2 is approximately 3ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
