Mouse Anti-Human SSH3
Human SSH3 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | FLJ10928, FLJ20515, SSH-3 |
| Accession Number | NP_060327 |
| Gene Symbols | SSH3 |
| Gene Id | 54961 |
| Applications | WB, ELISA, IP, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRI FPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPER FTYHNVRLWDEESAQLLPH |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.63 KDa). |
 | SSH3 monoclonal antibody Western Blot analysis of SSH3 expression in A-431 . |
 | Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate(73 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ~ 10 ug/ml] |
 | Immunoprecipitation of SSH3 transfected lysate using anti-SSH3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SSH3 monoclonal antibody. |
 | Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged SSH3 is approximately 0.3ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
