Mouse Anti-Human SUMO1
Human SUMO1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, SUMO-1, UBL1 |
| Accession Number | NP_001005781.1 |
| Gene Symbols | SUMO1 |
| Gene Id | 7341 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKM TTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGGHSTV |
| Gene Names | SUMO1 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (38 KDa). |
 | Western Blot analysis of SUMO1 expression in transfected 293T cell line by SUMO1 monoclonal antibody. Lane 1: SUMO1 transfected lysate (Predicted MW: 11.6 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to SUMO1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
 | Immunofluorescence of monoclonal antibody to SUMO1 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged SUMO1 is 0.1 ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
