Mouse Anti-Human SWAP70
Human SWAP70 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | FLJ39540, HSPC321, KIAA0640, SWAP-70 |
| Accession Number | NP_055870 |
| Gene Symbols | SWAP70 |
| Gene Id | 23075 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQ RVRELEDMYLKLQEALEDERQARQDEETVRKLQA |
| Gene Names | SWAP70 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Mouse, Rat |
 | Western Blot detection against Immunogen (33.88 KDa). |
 | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in human spleen. |
 | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in Raw 264.7. |
 | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in PC-12. |
 | SWAP70 monoclonal antibody Western Blot analysis of SWAP70 expression in NIH/3T3. |
 | Western Blot analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody. Lane 1: SWAP70 transfected lysate(69 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to SWAP70 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml] |
 | Detection limit for recombinant GST tagged SWAP70 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
