Mouse Anti-Human TCF12
Human TCF12 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | HEB, HTF4, HsT17266, bHLHb20 |
| Accession Number | NP_996919 |
| Gene Symbols | TCF12 |
| Gene Id | 6938 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQ LHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAV GPSTSLPAGH |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (35.64 KDa). |
 | Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF12 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | TCF12 monoclonal antibody Western Blot analysis of TCF12 expression in Jurkat . |
 | Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody. Lane 1: TCF12 transfected lysate(75.8 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml] |
 | Immunofluorescence of monoclonal antibody to TCF12 on HeLa cell. [antibody concentration 10 ug/ml] |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
