Mouse Anti-Human TMEM1
Human TMEM1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30 |
| Accession Number | NP_003265 |
| Gene Symbols | TRAPPC10 |
| Gene Id | 7109 |
| Applications | WB, ELISA |
| Isotype | kappa, Igg1 |
| Immunogen Sequence | VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDS SSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGT QVLVIPSQDDHVLEVS |
| Gene Names | TMEM1 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.3 KDa). |
 | Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | TMEM1 monoclonal antibody Western Blot analysis of TMEM1 expression in Hela NE . |
 | Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody. Lane 1: TMEM1 transfected lysate(142.2 KDa). Lane 2: Non-transfected lysate. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
