Mouse Anti-Human TMPRSS5

Human TMPRSS5 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11806
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms MGC141886, MGC148044, SPINESIN
Accession Number NP_110397.1
Gene Symbols TMPRSS5
Gene Id 80975
Applications WB, ELISA
Isotype kappa, Igg1
Immunogen Sequence HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPH PLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFP KGSRCWVSGWGHTHPSHTYS
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

MGC141886, MGC148044, SPINESIN

Description

Mouse monoclonal antibody raised against a partial recombinant TMPRSS5.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_030770

Preparation

Storage Buffer
1x PBS, pH 7.2

TMPRSS5 monoclonal antibody Western Blot analysis of TMPRSS5 expression in human kidney.
Western Blot analysis of TMPRSS5 expression in transfected 293T cell line by TMPRSS5 monoclonal antibody. Lane 1: TMPRSS5 transfected lysate (Predicted MW: 49.6 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged TMPRSS5 is 3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*