Human TRIM28 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | AAH04978 |
| Gene Id | 10155 |
| Gene Symbols | TRIM28 |
| Protein Name / Synonyms | FLJ29029, KAP1, RNF96, TF1B, TIF1B |
| Clonality | Monoclonal |
| Immunogen Sequence | IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNST GPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPY SSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLT ADSQPPVFKVFPGSTTEDYNLIVIER |
| Isotype | Kappa, IgG2b |
| Recommended Applications | ELISA, Immunofluorescence, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (41.69 KDa). |
![]() | Western blot analysis of TRIM28 over-expressed 293 cell line, cotransfected with TRIM28 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM28 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in PC-12 . |
![]() | TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in NIH/3T3 . |
![]() | TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in Hela NE . |
![]() | Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody. Lane 1: TRIM28 transfected lysate(88.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to TRIM28 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.
Anti-TRIM28 Antibody
Anti-TRIM28 Antibody