Mouse Anti-Human TRIM28
Human TRIM28 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | FLJ29029, KAP1, RNF96, TF1B, TIF1B |
| Accession Number | AAH04978 |
| Gene Symbols | TRIM28 |
| Gene Id | 10155 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2b |
| Immunogen Sequence | IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNST GPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPY SSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLT ADSQPPVFKVFPGSTTEDYNLIVIER |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Mouse, Rat |
 | Western Blot detection against Immunogen (41.69 KDa). |
 | Western blot analysis of TRIM28 over-expressed 293 cell line, cotransfected with TRIM28 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM28 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in PC-12 . |
 | TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in NIH/3T3 . |
 | TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in Hela NE . |
 | Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody. Lane 1: TRIM28 transfected lysate(88.5 KDa). Lane 2: Non-transfected lysate. |
 | Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
 | Immunofluorescence of monoclonal antibody to TRIM28 on HeLa cell. [antibody concentration 10 ug/ml] |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
