Mouse Anti-Human TYRO3
Human TYRO3 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | BYK, Brt, Dtk, FLJ16467, RSE, Sky, Tif |
| Accession Number | AAH49368 |
| Gene Symbols | TYRO3 |
| Gene Id | 7301 |
| Applications | WB, ELISA |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQL YIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQ PVWLTVEGVPFFTVEPKDLAV |
| Gene Names | TYRO3 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (36.52 KDa). |
 | Western blot analysis of TYRO3 over-expressed 293 cell line, cotransfected with TYRO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TYRO3 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | Western Blot analysis of TYRO3 expression in transfected 293T cell line by TYRO3 monoclonal antibody. Lane 1: TYRO3 transfected lysate(96.9 KDa). Lane 2: Non-transfected lysate. |
 | Detection limit for recombinant GST tagged TYRO3 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
