Mouse Anti-Human UPB1
Human UPB1 monoclonal antibody (100 ug)
Product Description
Specifications
Size | 100 ug |
---|---|
Protein Name / Synonyms | BUP1 |
Accession Number | NP_057411.1 |
Gene Symbols | UPB1 |
Gene Id | 51733 |
Applications | WB, ELISA, IHC, IF |
Isotype | kappa, Igg1 |
Immunogen Sequence | AINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDS SRTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEM YARELAEAVKSNYSPTIVKE |
More Information | Specificity Human |
Host Species | Mouse |
Clonality | Monoclonal |
Species | Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | UPB1 monoclonal antibody. Western Blot analysis of UPB1 expression in human liver. |
![]() | UPB1 monoclonal antibody. Western Blot analysis of UPB1 expression in Jurkat . |
![]() | Western Blot analysis of UPB1 expression in transfected 293T cell line by UPB1 monoclonal antibody . Lane 1: UPB1 transfected lysate (Predicted MW: 43.2 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to UPB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged UPB1 is 1 ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.