Mouse Anti-Human USF2
Human USF2 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | FIP, bHLHb12 |
| Accession Number | NP_003358 |
| Gene Symbols | USF2 |
| Gene Id | 7392 |
| Applications | WB, ELISA, IHC, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDG PGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYR VVQVTDGQLDGQGDTAGAVS |
| Gene Names | USF2 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human, Rat |
 | Western Blot detection against Immunogen (36.74 KDa). |
 | USF2 monoclonal antibody Western Blot analysis of USF2 expression in PC-12 . |
 | USF2 monoclonal antibody Western Blot analysis of USF2 expression in different cell lines. |
 | USF2 monoclonal antibody Western Blot analysis of USF2 expression in Hela NE . |
 | Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml] |
 | Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged USF2 is approximately 10ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
