Mouse Anti-Human VRK1
Human VRK1 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 ug |
|---|---|
| Protein Name / Synonyms | MGC117401, MGC138280, MGC142070 |
| Accession Number | NP_003375 |
| Gene Symbols | VRK1 |
| Gene Id | 7443 |
| Applications | WB, ELISA, IP, IF |
| Isotype | kappa, Igg2a |
| Immunogen Sequence | DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQ GLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESK EPGVEDTEWSNTQTEEAIQTRSRTRKRVQK |
| Gene Names | VRK1 |
| More Information | Specificity Human |
| Host Species | Mouse |
| Clonality | Monoclonal |
| Species | Human |
 | Western Blot detection against Immunogen (37.84 KDa). |
 | Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
 | Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody. Lane 1: VRK1 transfected lysate(45.5 KDa). Lane 2: Non-transfected lysate. |
 | Immunoprecipitation of VRK1 transfected lysate using anti-VRK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with VRK1 monoclonal antibody. |
 | Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell. [antibody concentration 10 ug/ml] |
 | Detection limit for recombinant GST tagged VRK1 is approximately 0.1ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
