3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 228-11161
| Size | 20 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Mouse |
| Accession Number | P97466 |
| Gene Id | 18121 |
| Protein Name / Synonyms | Noggin, SYM1, SYNS1, NOG. |
| Expressed Region | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC. |
| Expression System | E. coli |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a 0.2 umfiltered solution in 30% CH3CN, 0.1% TFA. |
| Activity | The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 1-2ng/ml of NOGGIN, corresponding to a specific activity of 500,000-1,000,000 u |
| Research Area | Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.