3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 228-11298
| Size | 5 mg, 25 mg |
| Estimated Lead Time | 2-3 weeks |
| Expressed Region | KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2. |
| Purity | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The protein was lyophilized with no additives. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.