Rabbit anti-Ferritin (N-term) Biotinylated Antibody, 50 ug
Loading...
Loading...
Loading...
Loading...
Anti-Ferritin (N-term) Antibody, Biotinylated
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P02794 |
| Gene Id | 2495 |
| Gene Symbols | FTH1 FTH FTHL6 OK/SW-cl.84 PIG15 |
| Clonality | Polyclonal |
| Immunogen | Immunogen was synthetic peptide derived from human Ferritin. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | CRAKNKIAKETNNKKKEFEETAEKVRCNSLVNLYLQASYTYLSLGFYFDR |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1:20000 (at least detecting 50 µg/ml)) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Research Area | Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.
Anti-Ferritin (N-term) Antibody, Biotinylated