Rabbit Anti-Human Ferritin (N-term) Antibody
Loading...
Loading...
Loading...
Loading...
Cell Lysate: Jurkat | Secondary Ab: Rabbit | Exposure: HDR | Expected MW (kDa): 20
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Specificity | The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat Ferritin has not yet been tested. |
| Accession Number | P02794 |
| Gene Id | 2495 |
| Gene Symbols | FTH1 FTH FTHL6 OK/SW-cl.84 PIG15 |
| Clonality | Polyclonal |
| Immunogen | Immunogen was synthetic peptide derived from human Ferritin. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | CRAKNKIAKETNNKKKEFEETAEKVRCNSLVNLYLQASYTYLSLGFYFDR |
| Recommended Applications | ELISA (recommended work dilution= 1:20000 (at least detecting 50ng/ml)) |
| Reconstitution | Supplied as lyophilized and purified antibody originally containing PBS, without Preservative Stabilizers, such as Sodium Azide. The final concentration is indicated on the shipping vial. The antibody is stable for at least years from the data of receipt when stored at -20°C to -70°C. Reconstituted antibody (recommended with H20 1 mg/ml) can also be aliquoted and stored frozen at -20°C to -70°C in a manual defrost freezer for months without detectable loss activity. Upon reconstitution, the antibody can also be stored over months at 4°C. Please avoid freeze-thaw cycles. |
| Research Area | Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |

Your cart is empty.
Cell Lysate: Jurkat | Secondary Ab: Rabbit | Exposure: HDR | Expected MW (kDa): 20