Recombinant human Abeta-40 protein with an N-terminal His-tag, derived from E. coli.
Loading...
Loading...
Loading...
Loading...
Product Description
Specifications
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | P05067 |
| Gene Id | 351 |
| Gene Symbols | APP A4 AD1 |
| Protein Name / Synonyms | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] |
| Expressed Region | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, 3 repeats with linkers. |
| Expression System | E. coli |
| Tag | N-terminal His-tag |
| Purity | >90% |
| Purity Determined By | SDS-PAGE under reducing conditions and visualized by Coomassie blue staining |
| Molecular Weight (kDa) | 15 kDa |
| Format | Liquid |
| Formulation | Filtered solution in 1x PBS (pH 8.0) |
| Concentration (lot specific) | Lot specific. See vial label, determined by Bio-Rad Bradford protein dye reagent concentrate. |
| Shipping Type | Blue ice |
| Storage | -20°C |
SDS-PAGE Image
Storage/Stability
Upon arrival, the liquid protein may be stored for 2 weeks at 4°C. For long term storage, it is recommended to store at -20°C or -80°C in appropriate aliquots. Avoid repeated freeze-thaw cycles.