3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Recombinant Human DEFENSIN BETA 2
Catalog #: DS-01-0084
Purified recombinant BD-2, expressed in E. coli
Product Description
Specifications
| Size | 20 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Protein Name / Synonyms | DEFENSIN BETA 2, |
| Expressed Region | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Expression System | E. coli |
| Purity | >98% by SDS PAGE and HPLC analysis. |
| Molecular Weight (kDa) | 4.3kD (41 amino acid sequence/residues) |
| Format | Purified recombinant protein - lyophilized |
| Concentration (lot specific) | ~0.1mg/ml after reconstitution |
| Preservative | None present |
| Activity | Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0-100.0 ng/ml. |
| Recommended Applications | ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane), ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane) |
| Endotoxin Level | <0.1ng/ug |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Recombinant human defensin beta-2 (BD-2), is a 4.3 kDa peptide comprised of 41 amino acid residues. BD-2, a member of the beta defensin family, is secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. This defensin is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.
Specifications
Size
20 ug
Stability & Storage
Storage/Stability
Prior to reconstitution store at +4°C.
After reconstitution store at -20°C.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. This protein may be stored for3 months from date of reconstitution.
After reconstitution store at -20°C.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. This protein may be stored for3 months from date of reconstitution.