3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Synthetic Human ACTH (aa1-39)
Catalog #: 229-20005
Product Description
Specifications
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Protein Name / Synonyms | ACTH, |
| Expressed Region | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Purity | HPLC: 98% |
| Molecular Weight (kDa) | 4541 Da |
| Format | Purified synthetic ACTH - liquid |
| Formulation | Trifluoroacetate salt |
| Concentration (lot specific) | Total protein concentration ~1.0mg/ml |
| Preservative | None present |
| Recommended Applications | ELISA |
| Shipping Type | Dry ice (additional shipping fee) |
| Storage | -20°C |
Description
Description
229-20005 is a synthetic peptide corresponding to full-length mature human ACTH, a secreted hormone that stimulates the synthesis and release of corticosteroids from the adrenal cortex.
Solid phase synthesis
Specifications
Size
100 ug
Stability & Storage
Storage/Stability
Store at -20°C only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use. This protein may be stored for18 months from date of dispatch.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use. This protein may be stored for18 months from date of dispatch.