Rabbit Anti-Human BNP-32 Antibody
Loading...
Loading...
Loading...
Loading...
Anti-BNP-32 Antibody
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Specificity | This antibody binds to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. |
| Accession Number | P16860 |
| Gene Id | 4879 |
| Gene Symbols | NPPB |
| Clonality | Polyclonal |
| Immunogen | The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH |
| Recommended Applications | ELISA (recommended work dilution= 1:2000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in PBS without preservatives. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Research Area | Angiogenesis, Neuroscience, Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.
Anti-BNP-32 Antibody