3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-BNP-32 Antibody
Catalog #: RB-13-0001
Rabbit Anti-Human BNP-32 Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Specificity | This antibody binds to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. |
| Accession Number | P16860 |
| Gene Id | 4879 |
| Gene Symbols | NPPB |
| Clonality | Polyclonal |
| Immunogen | The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH |
| Recommended Applications | ELISA (recommended work dilution= 1:2000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in PBS without preservatives. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Research Area | Angiogenesis, Neuroscience, Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
A polyhistidine-tag is an amino acid motif in proteins that consists of at least five histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as hexa-histidine tag, 6xHis-tag, and by the trademarked name His-tag. Polyhistidine-tags are often used for affinity purification of genetically modified proteins.
Immunohistochemistry (IHC) Analysis
Specificity
This antibody binds to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA.
Storage/Stability
Store at 4°C if intended for use within one month, otherwise, store at -20°C to -80°C. The lyophilized antibody is stable for at least 18 months after the date of receipt when stored at -20°C to -80°C. After reconstitution, it can be aliquoted and stored frozen at -20°C to -80°C in a manual defrost freezer for at least 6 months without detectable loss of activity. Upon reconstitution, the antibody can also be stored for 1 month at 4°C. Please avoid multiple freeze-thaw cycles, as this will lower the activity of the antibody.
Expiration
12 months from the date of shipment when stored properly.
References
- Maisel, A. et al., (2002). "Rapid measurement of B-type natriuretic peptide in the emergency diagnosis of heart failure". N Engl J Med 347 (3): 1617.
- Bhalla, V. et al., (2004). "B-type natriuretic peptide: the level and the drug--partners in the diagnosis of congestive heart failure". Congest Heart Fail 10 (1 Suppl 1): 327.