Human IL1F9 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_062564 |
| Gene Id | 56300 |
| Gene Symbols | IL1F9, IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1H1, IL1RP2, IL1F9 |
| Clonality | Monoclonal |
| Immunogen Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQ NLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQ NPEMCLYCEKVGEQPTLQLKEQKIMDLYGQdiv class="ty-product-feature__value">Partial recombinant protein with GST tag. ,MW of the GST tag alone is 26KDa. |
| Isotype | Kappa, IgG1 |
| Concentration (lot specific) | 0.46 mg/ml |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | Detection limit for recombinant GST tagged IL1F9 is 0.03 ng/ml as a capture antibody. |
Anti-IL1F9 Antibody
Anti-IL1F9 Antibody