3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-IL1F9 Antibody
Catalog #: 101-10804
Human IL1F9 monoclonal antibody (100 ug)
Product Description
Specifications
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_062564 |
| Gene Id | 56300 |
| Gene Symbols | IL1F9,IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1H1,IL1RP2,IL1F9 |
| Clonality | Monoclonal |
| Immunogen Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQ NLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQ NPEMCLYCEKVGEQPTLQLKEQKIMDLYGQdiv class="ty-product-feature__value">Partial recombinant protein with GST tag. ,MW of the GST tag alone is 26KDa. |
| Isotype | Kappa, IgG1 |
| Concentration (lot specific) | 0.46 mg/ml |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
Description
Description
Mouse monoclonal antibody raised against a partial recombinant IL1F9.
Gene Information
Gene Accession #
NM_019618
Preparation
Storage Buffer
1x PBS, pH 7.4
 | Western Blot detection against Immunogen (37.84 KDa). |
 | Detection limit for recombinant GST tagged IL1F9 is 0.03 ng/ml as a capture antibody. |
Storage
Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.