Loading...
Loading...
Loading...
Loading...
Heregulin-B2, Human Recombinant
| Size | 50 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | Q02297 |
| Gene Id | 3084 |
| Protein Name / Synonyms | Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1. |
| Expressed Region | shlvkcaekektfcvnggecfmvkdlsnpsrylckcpneftgdrcqnyvmasfykaeelyq. |
| Expression System | E. coli |
| Purity | Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a 0.2 um filtered solution in 20mM PB, pH 7.4, containing 150mM NaCl. |
| Activity | The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2×104 Units/mg. |
| Research Area | Cancer |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.
Heregulin-B2, Human Recombinant