3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10057
Human ALDH9A1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_000687 |
| Gene Id | 223 |
| Gene Symbols | ALDH9A1 |
| Protein Name / Synonyms | ALDH4, ALDH7, ALDH9, E3, TMABADH |
| Clonality | Monoclonal |
| Immunogen Sequence | CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGG AATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVT LELGGKSPLIIFSDCDMN |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunofluorescence, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | ALDH9A1 monoclonal antibody Western Blot analysis of ALDH9A1 expression in human liver. |
![]() | ALDH9A1 monoclonal antibody Western Blot analysis of ALDH9A1 expression in HeLa . |
![]() | Western Blot analysis of ALDH9A1 expression in transfected 293T cell line by ALDH9A1 monoclonal antibody. Lane 1: ALDH9A1 transfected lysate (Predicted MW: 53.8 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to ALDH9A1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged ALDH9A1 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.