3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10060
Human ALG12 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | NP_077010 |
| Gene Id | 79087 |
| Gene Symbols | ALG12 |
| Protein Name / Synonyms | ECM39, MGC111358, MGC3136, PP14673, hALG12 |
| Clonality | Monoclonal |
| Immunogen Sequence | NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQV NSAWRYDKREDVQPGTG |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (32.01 KDa). |
![]() | ALG12 monoclonal antibody Western Blot analysis of ALG12 expression in PC-12 . |
![]() | ALG12 monoclonal antibody Western Blot analysis of ALG12 expression in HeLa . |
![]() | Detection limit for recombinant GST tagged ALG12 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.